PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Brast03G183000.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family TALE
Protein Properties Length: 604aa    MW: 63819.8 Da    PI: 6.9592
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Brast03G183000.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.8e-093583951954
                         HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
            Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                         Fe   ++yps  ++  LA+++gL+ +qV++WF N R +
  Brast03G183000.2.p 358 FEHflHPYPSDVDKHILARQTGLSRSQVSNWFINARVR 395
                         554459******************************88 PP

2BELL87.11.9e-28219288271
                BELL   2 rqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeq 71 
                          +elq+ kakL ++leeVd+rY++y+eq+++v++sFea+ag  +a+ Yt+ A ++iS+hFr L+d +a q
  Brast03G183000.2.p 219 AAELQRLKAKLYTMLEEVDRRYRRYREQMRAVAGSFEAAAGRAAAAAYTRTAARTISKHFRTLRDGVAAQ 288
                         5799***************************************************************988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.2E-43147287IPR006563POX domain
PfamPF075267.3E-42153285IPR006563POX domain
PROSITE profilePS5007112.26336399IPR001356Homeobox domain
SMARTSM003892.5E-9339403IPR001356Homeobox domain
CDDcd000861.96E-12339400No hitNo description
SuperFamilySSF466893.38E-17340406IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-28342405IPR009057Homeodomain-like
PfamPF059207.9E-18356395IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 604 aa     Download sequence    Send to blast
MAHDHHPSLA GYADYFAAPG SGGATLVPEV DAAGEHDMYG GVGLHHHQSL PSGAEMFGLR  60
GFMAPGAAVS VAQSKQAAAL AVDEDDASSA AISFFRGEQQ HRQMMSQLQQ APLSLSLHGP  120
PPDAASPSSF MLQHQLGGEM AWQLQGAGAG WHLRGSRFLL PAQQLLQEFC SIPAETTEDT  180
AAKAPKRPAQ EEHPHGGGGG SSSSASWPAP SAQIQAMDAA ELQRLKAKLY TMLEEVDRRY  240
RRYREQMRAV AGSFEAAAGR AAAAAYTRTA ARTISKHFRT LRDGVAAQAR AVRVALGEKV  300
DAAAPPGMTK GETPRLRALD QCLRQHKAYQ SGVLESQPWR PQRGLPERAV SVLRAWLFEH  360
FLHPYPSDVD KHILARQTGL SRSQVSNWFI NARVRLWKPM VEEMYAEEMK DKEEGSGGAG  420
DQQYSAQLHA SSGADQLLGN PNPAAAGSYG GGGEQKPTRA QLHDAGSLAS VVSIGGRVHQ  480
QQQSLDFGMS TMDDDGGFDA YDAGGVHGFG ANAGAVSLTL GLQHHQHADP SRHHHHGGVN  540
VAASPSTSSA AAHGGGAAEF LFTAGEQHLG GQFGAADPAA SHYHHRGVLG GTSGFHLLRD  600
LAG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17345402158Homeobox protein Meis1
4xrs_B5e-17345402158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3584090.0AK358409.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1076A02.
GenBankAK3591120.0AK359112.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv1089L06.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003572007.10.0PREDICTED: BEL1-like homeodomain protein 4
TrEMBLI1I5P40.0I1I5P4_BRADI; Uncharacterized protein
STRINGBRADI3G32040.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36870.22e-71BEL1-like homeodomain 2